1.67 Rating by CuteStat

flyingcarpetdrivinginstructor.com is 8 months 4 days old. It is a domain having .com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, flyingcarpetdrivinginstructor.com is SAFE to browse.

Display Domain Stats or Pagerank Widget for this domain on your website. Click Here
Google Pagerank
PR 0 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
DMOZ Listing: No

Web Server Information

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:


Page Resources Breakdown

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.


- lugano-tourism.net

  Not Applicable   $ 8.95


- sirtasarim.com

  Not Applicable   $ 8.95


- pixeljunctioncreative.com

  Not Applicable   $ 8.95


- damlahastanesi.com

  Not Applicable   $ 8.95


- coresta.net

  6,827,761   $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.10.2
Date: Sun, 20 Nov 2016 04:11:02 GMT
Content-Type: text/html
Content-Length: 148
Connection: keep-alive

Domain Information

Registration Date: 2016-11-18 8 months 4 days 16 hours ago
Last Modified: 2016-11-18 8 months 4 days 16 hours ago
Expiration Date: 2017-11-18 3 months 2 weeks 3 days from now
Domain Status:

Domain Nameserver Information

Host IP Address Country
ns1.mytrafficmanagement.com United States United States
ns2.mytrafficmanagement.com United States United States

DNS Record Analysis

Host Type TTL Extra
flyingcarpetdrivinginstructor.com A 297 IP:
flyingcarpetdrivinginstructor.com NS 299 Target: ns2.mytrafficmanagement.com
flyingcarpetdrivinginstructor.com NS 299 Target: ns1.mytrafficmanagement.com
flyingcarpetdrivinginstructor.com SOA 299 MNAME: localhost
RNAME: admin.flyingcarpetdrivinginstructor.com
Serial: 100
Refresh: 10800
Retry: 3600
Expire: 604800

Similarly Ranked Websites


- google.com

  1   $ 8,833,062,960.00

Google Photos - All your photos organized and easy to find

- photos.google.com

All your photos are backed up safely, organized and labeled automatically, so you can find them fast, and share them how you like.

  1   $ 8,833,062,960.00

Google Sites

- sites.google.com

Thinking of creating a website? Google Sites is a free and easy way to create and share webpages.

  1   $ 8,833,062,960.00

Collections - Google+

- plus.google.com

Discover amazing things and connect with passionate people.

  1   $ 8,833,062,960.00

Google Help

- support.google.com

  1   $ 8,833,062,960.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Domain Name: flyingcarpetdrivinginstructor.com
Registry Domain ID: 2075224040_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.profilebuilder.com
Registrar URL: http://profilebuilder.com
Updated Date: 2016-11-18T21:42:31Z
Creation Date: 2016-11-18T21:42:31Z
Registrar Registration Expiration Date: 2017-11-18T21:42:31Z
Registrar: ProfileBuilder.com LLC
Registrar IANA ID: 1452
Registrar Abuse Contact Email: support@profilebuilder.com
Registrar Abuse Contact Phone: +1.6785060177
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Domain Administrator
Registrant Organization: China Capital Investment Limited
Registrant Street: 3/F Wisdom Centre 37 Hollywood Rd
Registrant City: Hong Kong
Registrant State/Province: Central
Registrant Postal Code: N/A
Registrant Country: HK
Registrant Phone: +1.6156287491
Registrant Phone Ext:
Registrant Fax: N/A
Registrant Fax Ext:
Registrant Email: bf1@sitematrix.com
Registry Admin ID:
Admin Name: Domain Administrator
Admin Organization: China Capital Investment Limited
Admin Street: 3/F Wisdom Centre 37 Hollywood Rd
Admin City: Hong Kong
Admin State/Province: Central
Admin Postal Code: N/A
Admin Country: HK
Admin Phone: +1.6156287491
Admin Phone Ext:
Admin Fax: N/A
Admin Fax Ext:
Admin Email: bf1@sitematrix.com
Registry Tech ID:
Tech Name: Domain Administrator
Tech Organization: China Capital Investment Limited
Tech Street: 3/F Wisdom Centre 37 Hollywood Rd
Tech City: Hong Kong
Tech State/Province: Central
Tech Postal Code: N/A
Tech Country: HK
Tech Phone: +1.6156287491
Tech Phone Ext:
Tech Fax: N/A
Tech Fax Ext:
Tech Email: bf1@sitematrix.com
Name Server: ns2.mytrafficmanagement.com
Name Server: ns1.mytrafficmanagement.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2016-11-19T23:11:04Z

Comments / Ratings / Reviews / Feedbacks for flyingcarpetdrivinginstructor.com