Sponsored Links

1.67 Rating by CuteStat

flyingcarpetdrivinginstructor.com is 5 months 5 days old. It is a domain having .com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, flyingcarpetdrivinginstructor.com is SAFE to browse.

Display Domain Stats or Pagerank Widget for this domain on your website. Click Here
Get Widget Code
Google Pagerank
PR 0 out of 10
PageSpeed Score
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
DMOZ Listing: No

Web Server Information

Hosted IP Address:

Hosted Country:

United States US

Location Latitude:


Location Longitude:


Page Resources Breakdown

Homepage Links Analysis

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable
Google+: Not Applicable

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e.


- lugano-tourism.net

  Not Applicable   $ 8.95


- sirtasarim.com

  Not Applicable   $ 8.95


- pixeljunctioncreative.com

  Not Applicable   $ 8.95


- damlahastanesi.com

  Not Applicable   $ 8.95


- coresta.net

  6,827,761   $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.10.2
Date: Sun, 20 Nov 2016 04:11:02 GMT
Content-Type: text/html
Content-Length: 148
Connection: keep-alive

Domain Information

Registration Date: 2016-11-18 5 months 5 days 6 minutes ago
Last Modified: 2016-11-18 5 months 5 days 6 minutes ago
Expiration Date: 2017-11-18 6 months 2 weeks 2 days from now
Domain Status:

DNS Record Analysis

Host Type TTL Extra
flyingcarpetdrivinginstructor.com A 297 IP:
flyingcarpetdrivinginstructor.com NS 299 Target: ns2.mytrafficmanagement.com
flyingcarpetdrivinginstructor.com NS 299 Target: ns1.mytrafficmanagement.com
flyingcarpetdrivinginstructor.com SOA 299 MNAME: localhost
RNAME: admin.flyingcarpetdrivinginstructor.com
Serial: 100
Refresh: 10800
Retry: 3600
Expire: 604800

Similarly Ranked Websites


- google.com

  1   $ 8,833,062,960.00

Google Photos - All your photos organized and easy to find

- photos.google.com

All your photos are backed up safely, organized and labeled automatically, so you can find them fast, and share them how you like.

  1   $ 8,833,062,960.00

Google Sites

- sites.google.com

Thinking of creating a website? Google Sites is a free and easy way to create and share webpages.

  1   $ 8,833,062,960.00

Collections - Google+

- plus.google.com

Discover amazing things and connect with passionate people.

  1   $ 8,833,062,960.00

Google Help

- support.google.com

  1   $ 8,833,062,960.00

Alexa Traffic Rank

Alexa Search Engine Traffic

Full WHOIS Lookup

Domain Name: flyingcarpetdrivinginstructor.com
Registry Domain ID: 2075224040_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.profilebuilder.com
Registrar URL: http://profilebuilder.com
Updated Date: 2016-11-18T21:42:31Z
Creation Date: 2016-11-18T21:42:31Z
Registrar Registration Expiration Date: 2017-11-18T21:42:31Z
Registrar: ProfileBuilder.com LLC
Registrar IANA ID: 1452
Registrar Abuse Contact Email: support@profilebuilder.com
Registrar Abuse Contact Phone: +1.6785060177
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Domain Administrator
Registrant Organization: China Capital Investment Limited
Registrant Street: 3/F Wisdom Centre 37 Hollywood Rd
Registrant City: Hong Kong
Registrant State/Province: Central
Registrant Postal Code: N/A
Registrant Country: HK
Registrant Phone: +1.6156287491
Registrant Phone Ext:
Registrant Fax: N/A
Registrant Fax Ext:
Registrant Email: bf1@sitematrix.com
Registry Admin ID:
Admin Name: Domain Administrator
Admin Organization: China Capital Investment Limited
Admin Street: 3/F Wisdom Centre 37 Hollywood Rd
Admin City: Hong Kong
Admin State/Province: Central
Admin Postal Code: N/A
Admin Country: HK
Admin Phone: +1.6156287491
Admin Phone Ext:
Admin Fax: N/A
Admin Fax Ext:
Admin Email: bf1@sitematrix.com
Registry Tech ID:
Tech Name: Domain Administrator
Tech Organization: China Capital Investment Limited
Tech Street: 3/F Wisdom Centre 37 Hollywood Rd
Tech City: Hong Kong
Tech State/Province: Central
Tech Postal Code: N/A
Tech Country: HK
Tech Phone: +1.6156287491
Tech Phone Ext:
Tech Fax: N/A
Tech Fax Ext:
Tech Email: bf1@sitematrix.com
Name Server: ns2.mytrafficmanagement.com
Name Server: ns1.mytrafficmanagement.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2016-11-19T23:11:04Z

Comments / Ratings / Reviews / Feedbacks for flyingcarpetdrivinginstructor.com